HIP1 monoclonal antibody (M02), clone 1E9 View larger

HIP1 monoclonal antibody (M02), clone 1E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HIP1 monoclonal antibody (M02), clone 1E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HIP1 monoclonal antibody (M02), clone 1E9

Brand: Abnova
Reference: H00003092-M02
Product name: HIP1 monoclonal antibody (M02), clone 1E9
Product description: Mouse monoclonal antibody raised against a partial recombinant HIP1.
Clone: 1E9
Isotype: IgG2a Kappa
Gene id: 3092
Gene name: HIP1
Gene alias: ILWEQ|MGC126506
Gene description: huntingtin interacting protein 1
Genbank accession: NM_005338
Immunogen: HIP1 (NP_005329, 928 a.a. ~ 1037 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DSPNLAQLQQASRGVNQATAGVVASTISGKSQIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKHYELAGVAEGWEEGTEASPPTLQEVVTEKE
Protein accession: NP_005329
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003092-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003092-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged HIP1 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HIP1 monoclonal antibody (M02), clone 1E9 now

Add to cart