HIF1A monoclonal antibody (M04), clone 2E23 View larger

HIF1A monoclonal antibody (M04), clone 2E23

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HIF1A monoclonal antibody (M04), clone 2E23

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HIF1A monoclonal antibody (M04), clone 2E23

Brand: Abnova
Reference: H00003091-M04
Product name: HIF1A monoclonal antibody (M04), clone 2E23
Product description: Mouse monoclonal antibody raised against a partial recombinant HIF1A.
Clone: 2E23
Isotype: IgG2b Kappa
Gene id: 3091
Gene name: HIF1A
Gene alias: HIF-1alpha|HIF1|HIF1-ALPHA|MOP1|PASD8|bHLHe78
Gene description: hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
Genbank accession: NM_001530
Immunogen: HIF1A (NP_001521, 717 a.a. ~ 826 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Protein accession: NP_001521
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003091-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003091-M04-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged HIF1A is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HIF1A monoclonal antibody (M04), clone 2E23 now

Add to cart