Brand: | Abnova |
Reference: | H00003091-M02 |
Product name: | HIF1A monoclonal antibody (M02), clone 1D4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HIF1A. |
Clone: | 1D4 |
Isotype: | IgG2b Kappa |
Gene id: | 3091 |
Gene name: | HIF1A |
Gene alias: | HIF-1alpha|HIF1|HIF1-ALPHA|MOP1|PASD8|bHLHe78 |
Gene description: | hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) |
Genbank accession: | NM_001530 |
Immunogen: | HIF1A (NP_001521, 717 a.a. ~ 826 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN |
Protein accession: | NP_001521 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged HIF1A is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |