HIC1 monoclonal antibody (M04), clone 2C1 View larger

HIC1 monoclonal antibody (M04), clone 2C1

H00003090-M04_50ug

New product

395,00 € tax excl.

50 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HIC1 monoclonal antibody (M04), clone 2C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about HIC1 monoclonal antibody (M04), clone 2C1

Brand: Abnova
Reference: H00003090-M04
Product name: HIC1 monoclonal antibody (M04), clone 2C1
Product description: Mouse monoclonal antibody raised against a full length recombinant HIC1.
Clone: 2C1
Isotype: IgG2a Kappa
Gene id: 3090
Gene name: HIC1
Gene alias: ZBTB29|hic-1
Gene description: hypermethylated in cancer 1
Genbank accession: NM_006497
Immunogen: HIC1 (NP_006488.2, 627 a.a. ~ 705 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG
Protein accession: NP_006488.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy HIC1 monoclonal antibody (M04), clone 2C1 now

Add to cart