Brand: | Abnova |
Reference: | H00003090-M01 |
Product name: | HIC1 monoclonal antibody (M01), clone 4E11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HIC1. |
Clone: | 4E11 |
Isotype: | IgG2b Kappa |
Gene id: | 3090 |
Gene name: | HIC1 |
Gene alias: | ZBTB29|hic-1 |
Gene description: | hypermethylated in cancer 1 |
Genbank accession: | NM_006497 |
Immunogen: | HIC1 (NP_006488, 396 a.a. ~ 453 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YKSSSEETGSSEDPSPPGGHLEGYPCPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLN |
Protein accession: | NP_006488 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.38 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to HIC1 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |