HHEX monoclonal antibody (M11), clone 2A10 View larger

HHEX monoclonal antibody (M11), clone 2A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HHEX monoclonal antibody (M11), clone 2A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about HHEX monoclonal antibody (M11), clone 2A10

Brand: Abnova
Reference: H00003087-M11
Product name: HHEX monoclonal antibody (M11), clone 2A10
Product description: Mouse monoclonal antibody raised against a full length recombinant HHEX.
Clone: 2A10
Isotype: IgG2b Kappa
Gene id: 3087
Gene name: HHEX
Gene alias: HEX|HMPH|HOX11L-PEN|PRH|PRHX
Gene description: hematopoietically expressed homeobox
Genbank accession: NM_002729
Immunogen: HHEX (NP_002720, 133 a.a. ~ 237 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCS
Protein accession: NP_002720
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003087-M11-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.55 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003087-M11-13-15-1.jpg
Application image note: Western Blot analysis of HHEX expression in transfected 293T cell line by HHEX monoclonal antibody (M11), clone 2A10.

Lane 1: HHEX transfected lysate(30.02 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HHEX monoclonal antibody (M11), clone 2A10 now

Add to cart