HGD purified MaxPab rabbit polyclonal antibody (D01P) View larger

HGD purified MaxPab rabbit polyclonal antibody (D01P)

H00003081-D01P_100ug

New product

384,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HGD purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about HGD purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00003081-D01P
Product name: HGD purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human HGD protein.
Gene id: 3081
Gene name: HGD
Gene alias: AKU|HGO
Gene description: homogentisate 1,2-dioxygenase (homogentisate oxidase)
Genbank accession: NM_000187.1
Immunogen: HGD (AAH71757.1, 1 a.a. ~ 445 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHYEAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN
Protein accession: AAH71757.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00003081-D01P-13-15-1.jpg
Application image note: Western Blot analysis of HGD expression in transfected 293T cell line (H00003081-T01) by HGD MaxPab polyclonal antibody.

Lane 1: HGD transfected lysate(50.00 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice
Publications: Adaptation of phenylalanine and tyrosine catabolic pathway to hibernation in bats.Pan YH, Zhang Y, Cui J, Liu Y, McAllan BM, Liao CC, Zhang S
PLoS One. 2013 Apr 19;8(4):e62039. doi: 10.1371/journal.pone.0062039. Print 2013.

Reviews

Buy HGD purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart