Brand: | Abnova |
Reference: | H00003077-M01 |
Product name: | HFE monoclonal antibody (M01), clone 1G12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HFE. |
Clone: | 1G12 |
Isotype: | IgG1 Kappa |
Gene id: | 3077 |
Gene name: | HFE |
Gene alias: | HFE1|HH|HLA-H|MGC103790|dJ221C16.10.1 |
Gene description: | hemochromatosis |
Genbank accession: | NM_000410 |
Immunogen: | HFE (NP_000401, 115 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQ |
Protein accession: | NP_000401 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to HFE on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Hemochromatosis Enhances Tumor Progression via Upregulation of Intracellular Iron in Head and Neck Cancer.Lenarduzzi M, Hui AB, Yue S, Ito E, Shi W, Williams J, Bruce J, Sakemura-Nakatsugawa N, Xu W, Schimmer A, Liu FF PLoS One. 2013 Aug 26;8(8):e74075. doi: 10.1371/journal.pone.0074075. |