CFH purified MaxPab rabbit polyclonal antibody (D01P) View larger

CFH purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CFH purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about CFH purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00003075-D01P
Product name: CFH purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human CFH protein.
Gene id: 3075
Gene name: CFH
Gene alias: ARMD4|ARMS1|CFHL3|FH|FHL1|HF|HF1|HF2|HUS|MGC88246
Gene description: complement factor H
Genbank accession: NM_001014975.1
Immunogen: CFH (NP_001014975.1, 1 a.a. ~ 449 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL
Protein accession: NP_001014975.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00003075-D01P-13-15-1.jpg
Application image note: Western Blot analysis of CFH expression in transfected 293T cell line (H00003075-T02) by CFH MaxPab polyclonal antibody.

Lane 1: CFH transfected lysate(51.00 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CFH purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart