HD monoclonal antibody (M12), clone 2A7 View larger

HD monoclonal antibody (M12), clone 2A7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HD monoclonal antibody (M12), clone 2A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about HD monoclonal antibody (M12), clone 2A7

Brand: Abnova
Reference: H00003064-M12
Product name: HD monoclonal antibody (M12), clone 2A7
Product description: Mouse monoclonal antibody raised against a partial recombinant HD.
Clone: 2A7
Isotype: IgG2b Kappa
Gene id: 3064
Gene name: HTT
Gene alias: HD|IT15
Gene description: huntingtin
Genbank accession: NM_002111
Immunogen: HD (NP_002102, 1524 a.a. ~ 1627 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKENEDKWKRLSRQIADIILPMLAKQQMHIDS
Protein accession: NP_002102
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003064-M12-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HD monoclonal antibody (M12), clone 2A7 now

Add to cart