HD monoclonal antibody (M06), clone 3F9 View larger

HD monoclonal antibody (M06), clone 3F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HD monoclonal antibody (M06), clone 3F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HD monoclonal antibody (M06), clone 3F9

Brand: Abnova
Reference: H00003064-M06
Product name: HD monoclonal antibody (M06), clone 3F9
Product description: Mouse monoclonal antibody raised against a partial recombinant HD.
Clone: 3F9
Isotype: IgG2b Kappa
Gene id: 3064
Gene name: HTT
Gene alias: HD|IT15
Gene description: huntingtin
Genbank accession: NM_002111
Immunogen: HD (NP_002102, 81 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW
Protein accession: NP_002102
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003064-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003064-M06-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged HD is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HD monoclonal antibody (M06), clone 3F9 now

Add to cart