HCLS1 monoclonal antibody (M05), clone 2A8 View larger

HCLS1 monoclonal antibody (M05), clone 2A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HCLS1 monoclonal antibody (M05), clone 2A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about HCLS1 monoclonal antibody (M05), clone 2A8

Brand: Abnova
Reference: H00003059-M05
Product name: HCLS1 monoclonal antibody (M05), clone 2A8
Product description: Mouse monoclonal antibody raised against a partial recombinant HCLS1.
Clone: 2A8
Isotype: IgG1 Kappa
Gene id: 3059
Gene name: HCLS1
Gene alias: CTTNL|HS1
Gene description: hematopoietic cell-specific Lyn substrate 1
Genbank accession: BC016758
Immunogen: HCLS1 (AAH16758, 266 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE
Protein accession: AAH16758
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003059-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003059-M05-1-9-1.jpg
Application image note: HCLS1 monoclonal antibody (M05), clone 2A8 Western Blot analysis of HCLS1 expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HCLS1 monoclonal antibody (M05), clone 2A8 now

Add to cart