Brand: | Abnova |
Reference: | H00003059-M03 |
Product name: | HCLS1 monoclonal antibody (M03), clone 2A6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HCLS1. |
Clone: | 2A6 |
Isotype: | IgG1 Kappa |
Gene id: | 3059 |
Gene name: | HCLS1 |
Gene alias: | CTTNL|HS1 |
Gene description: | hematopoietic cell-specific Lyn substrate 1 |
Genbank accession: | BC016758 |
Immunogen: | HCLS1 (AAH16758, 266 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE |
Protein accession: | AAH16758 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to HCLS1 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |