Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HCLS1 monoclonal antibody (M01), clone 3D5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA |
More info about HCLS1 monoclonal antibody (M01), clone 3D5
| Brand: | Abnova |
| Reference: | H00003059-M01 |
| Product name: | HCLS1 monoclonal antibody (M01), clone 3D5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HCLS1. |
| Clone: | 3D5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3059 |
| Gene name: | HCLS1 |
| Gene alias: | CTTNL|HS1 |
| Gene description: | hematopoietic cell-specific Lyn substrate 1 |
| Genbank accession: | BC016758 |
| Immunogen: | HCLS1 (AAH16758, 266 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE |
| Protein accession: | AAH16758 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HCLS1 monoclonal antibody (M01), clone 3D5 Western Blot analysis of HCLS1 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Endothelial cell dysfunction and cytoskeletal changes associated with repression of p16(INK4a) during immortalization.Kan CY, Wen VW, Pasquier E, Jankowski K, Chang M, Richards LA, Kavallaris M, Mackenzie KL. Oncogene. 2012 Feb 6. doi: 10.1038/onc.2011.645. [Epub ahead of print] |