HCCS purified MaxPab rabbit polyclonal antibody (D01P) View larger

HCCS purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HCCS purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about HCCS purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00003052-D01P
Product name: HCCS purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human HCCS protein.
Gene id: 3052
Gene name: HCCS
Gene alias: CCHL|DKFZp779I1858|MCOPS7
Gene description: holocytochrome c synthase (cytochrome c heme-lyase)
Genbank accession: BC001691.2
Immunogen: HCCS (AAH01691.1, 1 a.a. ~ 268 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS
Protein accession: AAH01691.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00003052-D01P-13-15-1.jpg
Application image note: Western Blot analysis of HCCS expression in transfected 293T cell line (H00003052-T02) by HCCS MaxPab polyclonal antibody.

Lane 1: HCCS transfected lysate(30.60 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HCCS purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart