HBZ monoclonal antibody (M03), clone 1G10 View larger

HBZ monoclonal antibody (M03), clone 1G10

H00003050-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HBZ monoclonal antibody (M03), clone 1G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about HBZ monoclonal antibody (M03), clone 1G10

Brand: Abnova
Reference: H00003050-M03
Product name: HBZ monoclonal antibody (M03), clone 1G10
Product description: Mouse monoclonal antibody raised against a full length recombinant HBZ.
Clone: 1G10
Isotype: IgG2b Kappa
Gene id: 3050
Gene name: HBZ
Gene alias: -
Gene description: hemoglobin, zeta
Genbank accession: NM_005332
Immunogen: HBZ (NP_005323, 1 a.a. ~ 81 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGAL
Protein accession: NP_005323
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003050-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.91 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003050-M03-13-15-1.jpg
Application image note: Western Blot analysis of HBZ expression in transfected 293T cell line by HBZ monoclonal antibody (M03), clone 1G10.

Lane 1: HBZ transfected lysate(15.6 KDa).
Lane 2: Non-transfected lysate.
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HBZ monoclonal antibody (M03), clone 1G10 now

Add to cart