Brand: | Abnova |
Reference: | H00003050-M01 |
Product name: | HBZ monoclonal antibody (M01), clone 3C4-1D5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant HBZ. |
Clone: | 3C4-1D5 |
Isotype: | IgG1 kappa |
Gene id: | 3050 |
Gene name: | HBZ |
Gene alias: | - |
Gene description: | hemoglobin, zeta |
Genbank accession: | BC027892 |
Immunogen: | HBZ (AAH27892, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR |
Protein accession: | AAH27892 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (41.36 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | HBZ monoclonal antibody (M01), clone 3C4-1D5 Western Blot analysis of HBZ expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |