HBG1 monoclonal antibody (M03), clone 1G8 View larger

HBG1 monoclonal antibody (M03), clone 1G8

H00003047-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HBG1 monoclonal antibody (M03), clone 1G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about HBG1 monoclonal antibody (M03), clone 1G8

Brand: Abnova
Reference: H00003047-M03
Product name: HBG1 monoclonal antibody (M03), clone 1G8
Product description: Mouse monoclonal antibody raised against a full-length recombinant HBG1.
Clone: 1G8
Isotype: IgG2a Kappa
Gene id: 3047
Gene name: HBG1
Gene alias: HBGA|HBGR|HSGGL1|PRO2979
Gene description: hemoglobin, gamma A
Genbank accession: BC010913
Immunogen: HBG1 (AAH10913, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAVMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH
Protein accession: AAH10913
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003047-M03-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged HBG1 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy HBG1 monoclonal antibody (M03), clone 1G8 now

Add to cart