HBB monoclonal antibody (M12), clone 7B24 View larger

HBB monoclonal antibody (M12), clone 7B24

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HBB monoclonal antibody (M12), clone 7B24

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about HBB monoclonal antibody (M12), clone 7B24

Brand: Abnova
Reference: H00003043-M12
Product name: HBB monoclonal antibody (M12), clone 7B24
Product description: Mouse monoclonal antibody raised against a partial recombinant HBB.
Clone: 7B24
Isotype: IgG1 Kappa
Gene id: 3043
Gene name: HBB
Gene alias: CD113t-C
Gene description: hemoglobin, beta
Genbank accession: BC007075
Immunogen: HBB (AAH07075, 38 a.a. ~ 147 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH
Protein accession: AAH07075
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003043-M12-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HBB monoclonal antibody (M12), clone 7B24 now

Add to cart