Brand: | Abnova |
Reference: | H00003043-M02A |
Product name: | HBB monoclonal antibody (M02A), clone 7B12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HBB. |
Clone: | 7B12 |
Isotype: | IgG1 Kappa |
Gene id: | 3043 |
Gene name: | HBB |
Gene alias: | CD113t-C |
Gene description: | hemoglobin, beta |
Genbank accession: | BC007075 |
Immunogen: | HBB (AAH07075, 38 a.a. ~ 147 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH |
Protein accession: | AAH07075 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |