Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HBB polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about HBB polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003043-A01 |
| Product name: | HBB polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HBB. |
| Gene id: | 3043 |
| Gene name: | HBB |
| Gene alias: | CD113t-C |
| Gene description: | hemoglobin, beta |
| Genbank accession: | BC007075 |
| Immunogen: | HBB (AAH07075, 38 a.a. ~ 147 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH |
| Protein accession: | AAH07075 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Spliceosome assembly is coupled to RNA polymerase II dynamics at the 3' end of human genes.Martins SB, Rino J, Carvalho T, Carvalho C, Yoshida M, Klose JM, de Almeida SF, Carmo-Fonseca M. Nat Struct Mol Biol. 2011 Sep 4. doi: 10.1038/nsmb.2124. [Epub ahead of print] |