Brand: | Abnova |
Reference: | H00003039-M02 |
Product name: | HBA1 monoclonal antibody (M02), clone 4F9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HBA1. |
Clone: | 4F9 |
Isotype: | IgG2a Kappa |
Gene id: | 3039 |
Gene name: | HBA1 |
Gene alias: | HBH|HBA-T3 |
Gene description: | hemoglobin, alpha 1 |
Genbank accession: | NM_000558 |
Immunogen: | HBA1 (NP_000549, 33 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR |
Protein accession: | NP_000549 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00003039-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00003039-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00003039-M02-2-A8-1.jpg](http://www.abnova.com/application_image/H00003039-M02-2-A8-1.jpg) |
Application image note: | HBA1 monoclonal antibody (M02), clone 4F9. Western Blot analysis of HBA1 expression in human placenta. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | The differentiating and apoptotic effects of 2-aza-5'-deoxycytidine are dependent on the PU.1 expression level in PU.1-transgenic K562 cells.Aoyama S, Nakano H, Danbara M, Higashihara M, Harigae H, Takahashi S. Biochem Biophys Res Commun. 2012 Mar 20. [Epub ahead of print] |