Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HBA1 monoclonal antibody (M02), clone 4F9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
More info about HBA1 monoclonal antibody (M02), clone 4F9
| Brand: | Abnova |
| Reference: | H00003039-M02 |
| Product name: | HBA1 monoclonal antibody (M02), clone 4F9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HBA1. |
| Clone: | 4F9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3039 |
| Gene name: | HBA1 |
| Gene alias: | HBH|HBA-T3 |
| Gene description: | hemoglobin, alpha 1 |
| Genbank accession: | NM_000558 |
| Immunogen: | HBA1 (NP_000549, 33 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR |
| Protein accession: | NP_000549 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HBA1 monoclonal antibody (M02), clone 4F9. Western Blot analysis of HBA1 expression in human placenta. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The differentiating and apoptotic effects of 2-aza-5'-deoxycytidine are dependent on the PU.1 expression level in PU.1-transgenic K562 cells.Aoyama S, Nakano H, Danbara M, Higashihara M, Harigae H, Takahashi S. Biochem Biophys Res Commun. 2012 Mar 20. [Epub ahead of print] |