Brand: | Abnova |
Reference: | H00003035-M03 |
Product name: | HARS monoclonal antibody (M03), clone 4D4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HARS. |
Clone: | 4D4 |
Isotype: | IgG2a Kappa |
Gene id: | 3035 |
Gene name: | HARS |
Gene alias: | FLJ20491|HRS |
Gene description: | histidyl-tRNA synthetase |
Genbank accession: | NM_002109 |
Immunogen: | HARS (NP_002100, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPV |
Protein accession: | NP_002100 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | HARS monoclonal antibody (M03), clone 4D4. Western Blot analysis of HARS expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |