Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HAL monoclonal antibody (M04), clone 4F2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,IP |
More info about HAL monoclonal antibody (M04), clone 4F2
| Brand: | Abnova |
| Reference: | H00003034-M04 |
| Product name: | HAL monoclonal antibody (M04), clone 4F2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HAL. |
| Clone: | 4F2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3034 |
| Gene name: | HAL |
| Gene alias: | HIS|HSTD |
| Gene description: | histidine ammonia-lyase |
| Genbank accession: | NM_002108 |
| Immunogen: | HAL (NP_002099, 558 a.a. ~ 657 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDIEAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTKIPESEDL |
| Protein accession: | NP_002099 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of HAL expression in transfected 293T cell line by HAL monoclonal antibody (M04), clone 4F2. Lane 1: HAL transfected lysate(72.698 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Histidase expression in human epidermal keratinocytes: Regulation by differentiation status and all-trans retinoic acid.Eckhart L, Schmidt M, Mildner M, Mlitz V, Abtin A, Ballaun C, Fischer H, Mrass P, Tschachler E. J Dermatol Sci. 2008 Jun;50(3):209-15. Epub 2008 Feb 15. |