Brand: | Abnova |
Reference: | H00003000-M02 |
Product name: | GUCY2D monoclonal antibody (M02), clone 6D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GUCY2D. |
Clone: | 6D9 |
Isotype: | IgG |
Gene id: | 3000 |
Gene name: | GUCY2D |
Gene alias: | CORD5|CORD6|CYGD|GUC1A4|GUC2D|LCA|LCA1|RETGC-1|ROS-GC1|retGC |
Gene description: | guanylate cyclase 2D, membrane (retina-specific) |
Genbank accession: | NM_000180 |
Immunogen: | GUCY2D (NP_000171, 521 a.a. ~ 630 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RKVAQGSRSSLGARSMSDIRSGPSQHLDSPNIGVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSEHCTRGSLQDL |
Protein accession: | NP_000171 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GUCY2D is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |