GUCY2D monoclonal antibody (M02), clone 6D9 View larger

GUCY2D monoclonal antibody (M02), clone 6D9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GUCY2D monoclonal antibody (M02), clone 6D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GUCY2D monoclonal antibody (M02), clone 6D9

Brand: Abnova
Reference: H00003000-M02
Product name: GUCY2D monoclonal antibody (M02), clone 6D9
Product description: Mouse monoclonal antibody raised against a partial recombinant GUCY2D.
Clone: 6D9
Isotype: IgG
Gene id: 3000
Gene name: GUCY2D
Gene alias: CORD5|CORD6|CYGD|GUC1A4|GUC2D|LCA|LCA1|RETGC-1|ROS-GC1|retGC
Gene description: guanylate cyclase 2D, membrane (retina-specific)
Genbank accession: NM_000180
Immunogen: GUCY2D (NP_000171, 521 a.a. ~ 630 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RKVAQGSRSSLGARSMSDIRSGPSQHLDSPNIGVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSEHCTRGSLQDL
Protein accession: NP_000171
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003000-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003000-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged GUCY2D is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GUCY2D monoclonal antibody (M02), clone 6D9 now

Add to cart