GZMH purified MaxPab mouse polyclonal antibody (B01P) View larger

GZMH purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GZMH purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about GZMH purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00002999-B01P
Product name: GZMH purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human GZMH protein.
Gene id: 2999
Gene name: GZMH
Gene alias: CCP-X|CGL-2|CSP-C|CTLA1|CTSGL2
Gene description: granzyme H (cathepsin G-like 2, protein h-CCPX)
Genbank accession: BC027974
Immunogen: GZMH (AAH27974, 1 a.a. ~ 246 a.a) full-length human protein.
Immunogen sequence/protein sequence: MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL
Protein accession: AAH27974
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002999-B01P-2-A2-1.jpg
Application image note: GZMH MaxPab polyclonal antibody. Western Blot analysis of GZMH expression in human colon.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GZMH purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart