GUK1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

GUK1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GUK1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about GUK1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00002987-D01P
Product name: GUK1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human GUK1 protein.
Gene id: 2987
Gene name: GUK1
Gene alias: GMK
Gene description: guanylate kinase 1
Genbank accession: NM_000858.4
Immunogen: GUK1 (NP_000849.1, 1 a.a. ~ 197 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
Protein accession: NP_000849.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00002987-D01P-2-A4-1.jpg
Application image note: GUK1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GUK1 expression in human spleen.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GUK1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart