GUK1 polyclonal antibody (A01) View larger

GUK1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GUK1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about GUK1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00002987-A01
Product name: GUK1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant GUK1.
Gene id: 2987
Gene name: GUK1
Gene alias: GMK
Gene description: guanylate kinase 1
Genbank accession: BC006249
Immunogen: GUK1 (AAH06249, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
Protein accession: AAH06249
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002987-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (47.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Age-Related Macular Degeneration and Retinal Protein Modification by 4-Hydroxy-2-nonenal.Ethen CM, Reilly C, Feng X, Olsen TW, Ferrington DA.
Invest Ophthalmol Vis Sci. 2007 Aug;48(8):3469-79.

Reviews

Buy GUK1 polyclonal antibody (A01) now

Add to cart