GUCY2C monoclonal antibody (M06), clone 3C2 View larger

GUCY2C monoclonal antibody (M06), clone 3C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GUCY2C monoclonal antibody (M06), clone 3C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GUCY2C monoclonal antibody (M06), clone 3C2

Brand: Abnova
Reference: H00002984-M06
Product name: GUCY2C monoclonal antibody (M06), clone 3C2
Product description: Mouse monoclonal antibody raised against a partial recombinant GUCY2C.
Clone: 3C2
Isotype: IgG2b Kappa
Gene id: 2984
Gene name: GUCY2C
Gene alias: GUC2C|STAR
Gene description: guanylate cyclase 2C (heat stable enterotoxin receptor)
Genbank accession: NM_004963.3
Immunogen: GUCY2C (NP_004954, 24 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL
Protein accession: NP_004954
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002984-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged GUCY2C is approximately 30ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GUCY2C monoclonal antibody (M06), clone 3C2 now

Add to cart