GUCY2C polyclonal antibody (A01) View larger

GUCY2C polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GUCY2C polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about GUCY2C polyclonal antibody (A01)

Brand: Abnova
Reference: H00002984-A01
Product name: GUCY2C polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant GUCY2C.
Gene id: 2984
Gene name: GUCY2C
Gene alias: GUC2C|STAR
Gene description: guanylate cyclase 2C (heat stable enterotoxin receptor)
Genbank accession: NM_004963.3
Immunogen: GUCY2C (NP_004954, 24 a.a. ~ 133 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL
Protein accession: NP_004954
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002984-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GUCY2C polyclonal antibody (A01) now

Add to cart