Brand: | Abnova |
Reference: | H00002982-M01 |
Product name: | GUCY1A3 monoclonal antibody (M01), clone 2H1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GUCY1A3. |
Clone: | 2H1 |
Isotype: | IgG2b Kappa |
Gene id: | 2982 |
Gene name: | GUCY1A3 |
Gene alias: | GC-SA3|GUC1A3|GUCA3|GUCSA3|GUCY1A1 |
Gene description: | guanylate cyclase 1, soluble, alpha 3 |
Genbank accession: | BC028384 |
Immunogen: | GUCY1A3 (AAH28384, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KATMPICQDIPEKNIQESLPQRKTSRSRVYLHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKTIAEQAVAAGVPVEVIKESLGEEV |
Protein accession: | AAH28384 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GUCY1A3 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |