GUCA2B purified MaxPab rabbit polyclonal antibody (D01P) View larger

GUCA2B purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GUCA2B purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about GUCA2B purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00002981-D01P
Product name: GUCA2B purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human GUCA2B protein.
Gene id: 2981
Gene name: GUCA2B
Gene alias: GCAP-II|UGN
Gene description: guanylate cyclase activator 2B (uroguanylin)
Genbank accession: NM_007102.1
Immunogen: GUCA2B (NP_009033.1, 1 a.a. ~ 112 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL
Protein accession: NP_009033.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00002981-D01P-13-15-1.jpg
Application image note: Western Blot analysis of GUCA2B expression in transfected 293T cell line (H00002981-T02) by GUCA2B MaxPab polyclonal antibody.

Lane 1: GUCA2B transfected lysate(12.10 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GUCA2B purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart