BRF1 monoclonal antibody (M01), clone 2E9 View larger

BRF1 monoclonal antibody (M01), clone 2E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BRF1 monoclonal antibody (M01), clone 2E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about BRF1 monoclonal antibody (M01), clone 2E9

Brand: Abnova
Reference: H00002972-M01
Product name: BRF1 monoclonal antibody (M01), clone 2E9
Product description: Mouse monoclonal antibody raised against a full length recombinant BRF1.
Clone: 2E9
Isotype: IgG1 Kappa
Gene id: 2972
Gene name: BRF1
Gene alias: BRF|FLJ42674|FLJ43034|GTF3B|MGC105048|TAF3B2|TAF3C|TAFIII90|TF3B90|TFIIIB90|hBRF
Gene description: BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae)
Genbank accession: BC016743
Immunogen: BRF1 (AAH16743, 1 a.a. ~ 208 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTGRVCRGCGGTDIELDAARGDTVCTACGSVLEDNIIMSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYPVCRTEGTPHMLLDLSDLLQVDSLRPASFPTWGCDLGVVTRVVTGVYPRCLHASQWPVCAACPVRKFWSVG
Protein accession: AAH16743
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002972-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (48.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002972-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged BRF1 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BRF1 monoclonal antibody (M01), clone 2E9 now

Add to cart