GTF2I monoclonal antibody (M02), clone 2D6 View larger

GTF2I monoclonal antibody (M02), clone 2D6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GTF2I monoclonal antibody (M02), clone 2D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about GTF2I monoclonal antibody (M02), clone 2D6

Brand: Abnova
Reference: H00002969-M02
Product name: GTF2I monoclonal antibody (M02), clone 2D6
Product description: Mouse monoclonal antibody raised against a full length recombinant GTF2I.
Clone: 2D6
Isotype: IgG2a Kappa
Gene id: 2969
Gene name: GTF2I
Gene alias: BAP-135|BAP135|BTKAP1|DIWS|FLJ38776|FLJ56355|IB291|SPIN|TFII-I|WBS|WBSCR6
Gene description: general transcription factor II, i
Genbank accession: BC004472
Immunogen: GTF2I (AAH04472.1, 36 a.a. ~ 274 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGISFIIKRPFLEPKKHVGGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSHHSSEGNEGTEMEVPAEG
Protein accession: AAH04472.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002969-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (52.03 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002969-M02-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to GTF2I on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GTF2I monoclonal antibody (M02), clone 2D6 now

Add to cart