GTF2H2 MaxPab mouse polyclonal antibody (B01) View larger

GTF2H2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GTF2H2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about GTF2H2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00002966-B01
Product name: GTF2H2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human GTF2H2 protein.
Gene id: 2966
Gene name: GTF2H2
Gene alias: BTF2|BTF2P44|MGC102806|T-BTF2P44|TFIIH
Gene description: general transcription factor IIH, polypeptide 2, 44kDa
Genbank accession: NM_001515.2
Immunogen: GTF2H2 (NP_001506.1, 1 a.a. ~ 395 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
Protein accession: NP_001506.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002966-B01-13-15-1.jpg
Application image note: Western Blot analysis of GTF2H2 expression in transfected 293T cell line (H00002966-T01) by GTF2H2 MaxPab polyclonal antibody.

Lane 1: GTF2H2 transfected lysate(43.45 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GTF2H2 MaxPab mouse polyclonal antibody (B01) now

Add to cart