GTF2A2 monoclonal antibody (M01), clone 2B9 View larger

GTF2A2 monoclonal antibody (M01), clone 2B9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GTF2A2 monoclonal antibody (M01), clone 2B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about GTF2A2 monoclonal antibody (M01), clone 2B9

Brand: Abnova
Reference: H00002958-M01
Product name: GTF2A2 monoclonal antibody (M01), clone 2B9
Product description: Mouse monoclonal antibody raised against a full-length recombinant GTF2A2.
Clone: 2B9
Isotype: IgG2a Kappa
Gene id: 2958
Gene name: GTF2A2
Gene alias: HsT18745|TF2A2|TFIIA
Gene description: general transcription factor IIA, 2, 12kDa
Genbank accession: BC000287
Immunogen: GTF2A2 (AAH00287, 1 a.a. ~ 109 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Protein accession: AAH00287
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002958-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002958-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged GTF2A2 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GTF2A2 monoclonal antibody (M01), clone 2B9 now

Add to cart