Brand: | Abnova |
Reference: | H00002958-M01 |
Product name: | GTF2A2 monoclonal antibody (M01), clone 2B9 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant GTF2A2. |
Clone: | 2B9 |
Isotype: | IgG2a Kappa |
Gene id: | 2958 |
Gene name: | GTF2A2 |
Gene alias: | HsT18745|TF2A2|TFIIA |
Gene description: | general transcription factor IIA, 2, 12kDa |
Genbank accession: | BC000287 |
Immunogen: | GTF2A2 (AAH00287, 1 a.a. ~ 109 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE |
Protein accession: | AAH00287 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GTF2A2 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |