GTF2A1 polyclonal antibody (A01) View larger

GTF2A1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GTF2A1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about GTF2A1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00002957-A01
Product name: GTF2A1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant GTF2A1.
Gene id: 2957
Gene name: GTF2A1
Gene alias: MGC129969|MGC129970|TF2A1|TFIIA
Gene description: general transcription factor IIA, 1, 19/37kDa
Genbank accession: NM_015859
Immunogen: GTF2A1 (NP_056943, 1 a.a. ~ 63 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEE
Protein accession: NP_056943
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002957-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.04 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GTF2A1 polyclonal antibody (A01) now

Add to cart