Brand: | Abnova |
Reference: | H00002956-M01 |
Product name: | MSH6 monoclonal antibody (M01), clone 1F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MSH6. |
Clone: | 1F2 |
Isotype: | IgG1 kappa |
Gene id: | 2956 |
Gene name: | MSH6 |
Gene alias: | GTBP|HNPCC5|HSAP |
Gene description: | mutS homolog 6 (E. coli) |
Genbank accession: | NM_000179 |
Immunogen: | MSH6 (NP_000170, 931 a.a. ~ 1030 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLK |
Protein accession: | NP_000170 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MSH6 is approximately 1ng/ml as a capture antibody. |
Applications: | WB-Ti,IF,S-ELISA,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |