Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GSTT1 monoclonal antibody (M01), clone 2E10-1B2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about GSTT1 monoclonal antibody (M01), clone 2E10-1B2
| Brand: | Abnova |
| Reference: | H00002952-M01 |
| Product name: | GSTT1 monoclonal antibody (M01), clone 2E10-1B2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant GSTT1. |
| Clone: | 2E10-1B2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2952 |
| Gene name: | GSTT1 |
| Gene alias: | - |
| Gene description: | glutathione S-transferase theta 1 |
| Genbank accession: | BC007065 |
| Immunogen: | GSTT1 (AAH07065, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR |
| Protein accession: | AAH07065 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (52.14 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Anti-glutathione S-transferase T1 antibody-mediated rejection in C4d-positive renal allograft recipients.Aguilera I, Alvarez-Marquez A, Gentil MA, Fernandez-Alonso J, Fijo J, Saez C, Wichmann I, Nunez-Roldan A. Nephrol Dial Transplant. 2008 Jul;23(7):2393-8. Epub 2008 Feb 28. |