Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GSTP1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Ti,WB-Tr,PLA-Ce |
More info about GSTP1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00002950-D01P |
| Product name: | GSTP1 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human GSTP1 protein. |
| Gene id: | 2950 |
| Gene name: | GSTP1 |
| Gene alias: | DFN7|FAEES3|GST3|PI |
| Gene description: | glutathione S-transferase pi 1 |
| Genbank accession: | BC010915.1 |
| Immunogen: | GSTP1 (AAH10915.1, 1 a.a. ~ 210 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
| Protein accession: | AAH10915.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Western Blot analysis of GSTP1 expression in transfected 293T cell line (H00002950-T01) by GSTP1 MaxPab polyclonal antibody. Lane 1: GSTP1 transfected lysate(23.30 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Ti,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | Phosphorylation of Glutathione S-Transferase P1 (GSTP1) by Epidermal Growth Factor Receptor (EGFR) Promotes Formation of the GSTP1-c-Jun N-terminal kinase (JNK) Complex and Suppresses JNK Downstream Signaling and Apoptosis in Brain Tumor Cells.Okamura T, Antoun G, Keir ST, Friedman H, Bigner DD, Ali-Osman F. J Biol Chem. 2015 Dec 25;290(52):30866-78. doi: 10.1074/jbc.M115.656140. Epub 2015 Oct 1. |