Brand: | Abnova |
Reference: | H00002949-M02 |
Product name: | GSTM5 monoclonal antibody (M02), clone 1G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GSTM5. |
Clone: | 1G4 |
Isotype: | IgG1 Kappa |
Gene id: | 2949 |
Gene name: | GSTM5 |
Gene alias: | GSTM5-5|GTM5 |
Gene description: | glutathione S-transferase mu 5 |
Genbank accession: | NM_000851 |
Immunogen: | GSTM5 (NP_000842, 145 a.a. ~ 218 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK |
Protein accession: | NP_000842 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GSTM5 is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |