GSTM5 purified MaxPab rabbit polyclonal antibody (D01P) View larger

GSTM5 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GSTM5 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about GSTM5 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00002949-D01P
Product name: GSTM5 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human GSTM5 protein.
Gene id: 2949
Gene name: GSTM5
Gene alias: GSTM5-5|GTM5
Gene description: glutathione S-transferase mu 5
Genbank accession: NM_000851.2
Immunogen: GSTM5 (NP_000842.2, 1 a.a. ~ 218 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
Protein accession: NP_000842.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00002949-D01P-13-15-1.jpg
Application image note: Western Blot analysis of GSTM5 expression in transfected 293T cell line (H00002949-T01) by GSTM5 MaxPab polyclonal antibody.

Lane 1: GSTM5 transfected lysate(25.70 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GSTM5 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart