GSTM4 purified MaxPab rabbit polyclonal antibody (D01P) View larger

GSTM4 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GSTM4 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about GSTM4 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00002948-D01P
Product name: GSTM4 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human GSTM4 protein.
Gene id: 2948
Gene name: GSTM4
Gene alias: GSTM4-4|GTM4|MGC131945|MGC9247
Gene description: glutathione S-transferase mu 4
Genbank accession: NM_000850.3
Immunogen: GSTM4 (NP_000841.1, 1 a.a. ~ 218 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
Protein accession: NP_000841.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00002948-D01P-2-A1-1.jpg
Application image note: GSTM4 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTM4 expression in human liver.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GSTM4 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart