GSTM2 monoclonal antibody (M03), clone 1E10 View larger

GSTM2 monoclonal antibody (M03), clone 1E10

H00002946-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GSTM2 monoclonal antibody (M03), clone 1E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about GSTM2 monoclonal antibody (M03), clone 1E10

Brand: Abnova
Reference: H00002946-M03
Product name: GSTM2 monoclonal antibody (M03), clone 1E10
Product description: Mouse monoclonal antibody raised against a partial recombinant GSTM2.
Clone: 1E10
Isotype: IgG1 Kappa
Gene id: 2946
Gene name: GSTM2
Gene alias: GST4|GSTM|GSTM2-2|GTHMUS|MGC117303
Gene description: glutathione S-transferase mu 2 (muscle)
Genbank accession: NM_000848
Immunogen: GSTM2 (NP_000839, 90 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFE
Protein accession: NP_000839
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002946-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00002946-M03-1-8-1.jpg
Application image note: GSTM2 monoclonal antibody (M03), clone 1E10. Western Blot analysis of GSTM2 expression in NIH/3T3 ( Cat # L018V1 ).
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: A DNA hypermethylation profile reveals new potential biomarkers for prostate cancer diagnosis and prognosis.Ashour N, Angulo JC, Andres G, Alelu R, Gonzalez-Corpas A, Toledo MV, Rodriguez-Barbero JM, Lopez JI, Sanchez-Chapado M, Ropero S
Prostate. 2014 Sep;74(12):1171-82. doi: 10.1002/pros.22833. Epub 2014 Jun 24.

Reviews

Buy GSTM2 monoclonal antibody (M03), clone 1E10 now

Add to cart