H00002946-M03_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Mouse |
Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00002946-M03 |
Product name: | GSTM2 monoclonal antibody (M03), clone 1E10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GSTM2. |
Clone: | 1E10 |
Isotype: | IgG1 Kappa |
Gene id: | 2946 |
Gene name: | GSTM2 |
Gene alias: | GST4|GSTM|GSTM2-2|GTHMUS|MGC117303 |
Gene description: | glutathione S-transferase mu 2 (muscle) |
Genbank accession: | NM_000848 |
Immunogen: | GSTM2 (NP_000839, 90 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFE |
Protein accession: | NP_000839 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | GSTM2 monoclonal antibody (M03), clone 1E10. Western Blot analysis of GSTM2 expression in NIH/3T3 ( Cat # L018V1 ). |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | A DNA hypermethylation profile reveals new potential biomarkers for prostate cancer diagnosis and prognosis.Ashour N, Angulo JC, Andres G, Alelu R, Gonzalez-Corpas A, Toledo MV, Rodriguez-Barbero JM, Lopez JI, Sanchez-Chapado M, Ropero S Prostate. 2014 Sep;74(12):1171-82. doi: 10.1002/pros.22833. Epub 2014 Jun 24. |