GSTA4 MaxPab mouse polyclonal antibody (B01) View larger

GSTA4 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GSTA4 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about GSTA4 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00002941-B01
Product name: GSTA4 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human GSTA4 protein.
Gene id: 2941
Gene name: GSTA4
Gene alias: DKFZp686D21185|GSTA4-4|GTA4
Gene description: glutathione S-transferase alpha 4
Genbank accession: BC015523
Immunogen: GSTA4 (AAH15523, 1 a.a. ~ 222 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Protein accession: AAH15523
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002941-B01-13-15-1.jpg
Application image note: Western Blot analysis of GSTA4 expression in transfected 293T cell line (H00002941-T01) by GSTA4 MaxPab polyclonal antibody.

Lane 1: GSTA4 transfected lysate(24.53 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GSTA4 MaxPab mouse polyclonal antibody (B01) now

Add to cart