Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GSTA4 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about GSTA4 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00002941-A01 |
| Product name: | GSTA4 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant GSTA4. |
| Gene id: | 2941 |
| Gene name: | GSTA4 |
| Gene alias: | DKFZp686D21185|GSTA4-4|GTA4 |
| Gene description: | glutathione S-transferase alpha 4 |
| Genbank accession: | NM_001512 |
| Immunogen: | GSTA4 (NP_001503, 168 a.a. ~ 222 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP |
| Protein accession: | NP_001503 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.16 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Carbonylation of adipose proteins in obesity and insulin resistance: Identification of adipocyte fatty acid-binding protein as a cellular target of 4-hydroxynonenal.Grimsrud PA, Picklo MJ Sr, Griffin TJ, Bernlohr DA. Mol Cell Proteomics. 2007 Apr;6(4):624-37. Epub 2007 Jan 6. |