GSTA3 monoclonal antibody (M01), clone 1F11 View larger

GSTA3 monoclonal antibody (M01), clone 1F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GSTA3 monoclonal antibody (M01), clone 1F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about GSTA3 monoclonal antibody (M01), clone 1F11

Brand: Abnova
Reference: H00002940-M01
Product name: GSTA3 monoclonal antibody (M01), clone 1F11
Product description: Mouse monoclonal antibody raised against a full length recombinant GSTA3.
Clone: 1F11
Isotype: IgG2a Kappa
Gene id: 2940
Gene name: GSTA3
Gene alias: GSTA3-3|GTA3|MGC22232
Gene description: glutathione S-transferase alpha 3
Genbank accession: BC020619
Immunogen: GSTA3 (AAH20619, 1 a.a. ~ 222 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF
Protein accession: AAH20619
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002940-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (50.16 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002940-M01-3-5-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to GSTA3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GSTA3 monoclonal antibody (M01), clone 1F11 now

Add to cart