Brand: | Abnova |
Reference: | H00002939-M05 |
Product name: | GSTA2 monoclonal antibody (M05), clone 3D4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GSTA2. |
Clone: | 3D4 |
Isotype: | IgG1 Kappa |
Gene id: | 2939 |
Gene name: | GSTA2 |
Gene alias: | GST2|GSTA2-2|GTA2|GTH2|MGC10525 |
Gene description: | glutathione S-transferase alpha 2 |
Genbank accession: | BC002895 |
Immunogen: | GSTA2 (AAH02895, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIA |
Protein accession: | AAH02895 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | GSTA2 monoclonal antibody (M05), clone 3D4. Western Blot analysis of GSTA2 expression in HepG2(Cat # L019V1 ). |
Applications: | WB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |