GSTA2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

GSTA2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GSTA2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about GSTA2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00002939-D01P
Product name: GSTA2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human GSTA2 protein.
Gene id: 2939
Gene name: GSTA2
Gene alias: GST2|GSTA2-2|GTA2|GTH2|MGC10525
Gene description: glutathione S-transferase alpha 2
Genbank accession: NM_000846.3
Immunogen: GSTA2 (NP_000837.2, 1 a.a. ~ 222 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF
Protein accession: NP_000837.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00002939-D01P-2-A1-1.jpg
Application image note: GSTA2 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTA2 expression in human liver.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GSTA2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart