GRP monoclonal antibody (M03), clone 3A11 View larger

GRP monoclonal antibody (M03), clone 3A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GRP monoclonal antibody (M03), clone 3A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about GRP monoclonal antibody (M03), clone 3A11

Brand: Abnova
Reference: H00002922-M03
Product name: GRP monoclonal antibody (M03), clone 3A11
Product description: Mouse monoclonal antibody raised against a full-length recombinant GRP.
Clone: 3A11
Isotype: IgG2b Kappa
Gene id: 2922
Gene name: GRP
Gene alias: BN|GRP-10|preproGRP|proGRP
Gene description: gastrin-releasing peptide
Genbank accession: BC004488
Immunogen: GRP (AAH04488, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
Protein accession: AAH04488
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002922-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (42.02 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002922-M03-13-15-1.jpg
Application image note: Western Blot analysis of GRP expression in transfected 293T cell line by GRP monoclonal antibody (M03), clone 3A11.

Lane 1: GRP transfected lysate(16.39 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GRP monoclonal antibody (M03), clone 3A11 now

Add to cart